PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sopen07g008660.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family CPP
Protein Properties Length: 570aa    MW: 61902.1 Da    PI: 7.5452
Description CPP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sopen07g008660.1genomespennView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCR45.51.5e-14124163242
               TCR   2 ekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNkeek 42 
                       + k+CnCk+s+Clk+YCeCfa+g +C+  C+C +C+N+ e+
  Sopen07g008660.1 124 KPKQCNCKHSRCLKLYCECFASGIFCDG-CNCANCHNNVEN 163
                       5699************************.********9875 PP

2TCR50.93e-16208247140
               TCR   1 kekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNke 40 
                       k++kgC+Ckks ClkkYCeCf+a+  Cse+C+C dCkN e
  Sopen07g008660.1 208 KHNKGCHCKKSGCLKKYCECFQANILCSENCRCMDCKNFE 247
                       589***********************************76 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM011144.5E-16123163IPR033467Tesmin/TSO1-like CXC domain
PROSITE profilePS5163436.619124248IPR005172CRC domain
PfamPF036389.4E-12126160IPR005172CRC domain
SMARTSM011141.6E-19208249IPR033467Tesmin/TSO1-like CXC domain
PfamPF036381.3E-12211246IPR005172CRC domain
Sequence ? help Back to Top
Protein Sequence    Length: 570 aa     Download sequence    Send to blast
MEKIEEGHFP PKKAESEAAS VQVETDNPAK KLARQLDFTG GVPGQALTVS LQEHANQIIQ  60
PEVIKSSQLT VSMKSTQLIS PQPQLQQHIL LMPMQQAPVL PPQPLIRPLS MQSSSEAKDG  120
TPKKPKQCNC KHSRCLKLYC ECFASGIFCD GCNCANCHNN VENEASRQEA VEATLERNPN  180
AFRPKIASSP HGTREEREEA GDGLVLPKHN KGCHCKKSGC LKKYCECFQA NILCSENCRC  240
MDCKNFEGNE ERQAHFHGDH ANNMAYLQQT ANVAITGAIG SSGYGSPPVN KNRKIQELFS  300
GSMIKDPVHR LGQFQQENQI KASVPPSLLS SIPGTRVSNA AALGPPKLNY RSLLADIIQN  360
HDIKELCSVL IVYAQEAAKI LSDEKDASLK QAKHHRKASY PSSGVGKVLR DDCSTGIQAE  420
SIMVDDSRLD GADVSAERPI SPGTLALMCD EQDTTFTAAA APPNDLTSLS NNTSSQLPHG  480
QGRAEIYPEL ESIVLAQTRD CLKKLITLGE IKEKKCSLMV RDTDSGRQNN VSSNGIVNTV  540
PPPPPPQQKV DSGTTAANTT RPKVHPPDGK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0134470.0BT013447.1 Lycopersicon esculentum clone 132102R, mRNA sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015080427.10.0PREDICTED: protein tesmin/TSO1-like CXC 5 isoform X1
SwissprotQ9SZD11e-164TCX5_ARATH; Protein tesmin/TSO1-like CXC 5
TrEMBLK4CCT30.0K4CCT3_SOLLC; Uncharacterized protein
STRINGSolyc07g020710.2.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA24012455
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G29000.11e-165Tesmin/TSO1-like CXC domain-containing protein